PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_20987
Common NameKK1_021616
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 345aa    MW: 38811.6 Da    PI: 6.2377
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_20987genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.82.9e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lvd+++++G g+W++ ++  g++R++k+c++rw +yl
    C.cajan_20987 14 KGPWTPEEDRILVDYIQKHGHGSWRALPKLAGLNRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding57.14e-1867112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++++eE++l++++++ lG++ W++Ia +++ gRt++++k++w+++l
    C.cajan_20987  67 RGKFSEEEEQLIINLHAVLGNK-WSSIAGHLP-GRTDNEIKNFWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.612961IPR017930Myb domain
SuperFamilySSF466892.48E-3211108IPR009057Homeodomain-like
SMARTSM007177.5E-161363IPR001005SANT/Myb domain
PfamPF002491.4E-171461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.3E-251568IPR009057Homeodomain-like
CDDcd001673.14E-121661No hitNo description
PROSITE profilePS5129428.17362116IPR017930Myb domain
SMARTSM007174.8E-1766114IPR001005SANT/Myb domain
PfamPF002499.2E-1767112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.5E-2869117IPR009057Homeodomain-like
CDDcd001671.18E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MGRTAWGDES GLKKGPWTPE EDRILVDYIQ KHGHGSWRAL PKLAGLNRCG KSCRLRWTNY  60
LRPDIKRGKF SEEEEQLIIN LHAVLGNKWS SIAGHLPGRT DNEIKNFWNT HLKKKLMQMG  120
LDPVTHRPRS DHLNLLSNLQ QLLAATNIFS NFTNTWDINA LSMQSDATQL AKLQLLQNIL  180
QVLGANPTSN MELLNPFGPP SSLQDGFLNE VLGLNQSKLQ DLCNGFPSQN QPNFQNFEAP  240
PHQQQTLPSG FQHMSGCRNS SCMKSEKVEE QLDAPISSSS STQLFNSLPN LVSASPECST  300
VKQMENKGNT NECSDPCNST STTFEMWGDF MYEEVSEAYW KDLLE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-29121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB1086510.0AB108651.1 Glycine max MYB101 mRNA for transcription factor MYB101, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006592013.20.0PREDICTED: transcription factor MYB39
TrEMBLA0A151TLU50.0A0A151TLU5_CAJCA; Transcription factor MYB39
STRINGGLYMA12G01960.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40234172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.26e-94myb domain protein 9